Shonda 1020 Fitness / Food / Lifestyle
  • Home
  • About
  • Workouts
  • RECIPES
  • Blog
  • Store
    • My Account
    • Cart
    • Checkout
    • Create an Account
  • Contact

Hawaiian Style Chicken Packet

#easyrecipes#familydinnerchickenfamiliyrecipemeat+veggiesveggiesVeggies+Meat

Subscribe to Blog via Email

Enter your email to subscribe to my blog and get notifications of new posts by email.

Search ShondaFit.com

Latest Recipies

  • Breakfast Bars
    Breakfast Bars Ingredients: 3  ripe bananas 3/4 cup peanut butter (softened) 1/3 cup ...read more »
  • Beef Stir Fry
    Beef Stir Fry For the stir fry 2 lbs thinly sliced steak (I used sirloin) 4 cups of ...read more »
  • Protein Oats
    Protein Oats, overnight oats, heaven in a jar…whatever you’d like to call them-you’ll ...read more »

Recent Blog Posts

  • Cabana Project
  • Breakfast Bars
    Breakfast Bars Ingredients: 3  ripe bananas 3/4 cup peanut butter (softened) 1/3 cup ...read more »
  • Beef Stir Fry
    Beef Stir Fry For the stir fry 2 lbs thinly sliced steak (I used sirloin) 4 cups of ...read more »

Shopping Bag

 

  • Home
  • About
  • Workouts
  • RECIPES
  • Blog
  • Store
    • My Account
    • Cart
    • Checkout
    • Create an Account
  • Contact
    
Shonda 1020 Fitness / Food / Lifestyle
© 2019 Shonda Fit. All rights reserved.
  • Home
  • About
  • Workouts
  • RECIPES
  • Blog
  • Store
    • My Account
    • Cart
    • Checkout
    • Create an Account
  • Contact
SUBSCRIBE NOW

Subscribe to my newsletter!

Get all of my latest recipes, workouts, and more through periodic email updates. Don't worry about getting bombarded as I promise never to send more than one a month :)
Your privacy is important to me, so I won't share, sell, or misuse your email address and you can easily unsubscribe at any time :)
close-link